VAMP3/Cellubrevin Antibody (2H8R8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16705

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16705-100ul
NBP3-16705-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2H8R8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all VAMP3/Cellubrevin Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VAMP3/Cellubrevin (Q15836). MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP3/Cellubrevin Antibody (2H8R8)

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Analysis of extracts of various cell lines, using VAMP3/VAMP3/Cellubrevin Rabbit mAb (NBP3-16705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Immunocytochemistry/ Immunofluorescence: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Immunocytochemistry/Immunofluorescence: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Immunofluorescence analysis of U-2 OS cells using VAMP3/VAMP3/Cellubrevin Rabbit mAb (NBP3-16705) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705]

Western Blot: VAMP3/Cellubrevin Antibody (2H8R8) [NBP3-16705] - Analysis of extracts of Mouse liver, using VAMP3/VAMP3/Cellubrevin Rabbit mAb (NBP3-16705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Applications for VAMP3/Cellubrevin Antibody (2H8R8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAMP3/Cellubrevin

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP-25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, all VAMP isoform levels appear to be significantly reduced.

Alternate Names

CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin)

Gene Symbol

VAMP3

Additional VAMP3/Cellubrevin Products

Product Documents for VAMP3/Cellubrevin Antibody (2H8R8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for VAMP3/Cellubrevin Antibody (2H8R8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.