VDAC2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80065

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-80065
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all VDAC2 Antibodies »

Product Summary for VDAC2 Antibody

Immunogen

The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2 Synthetic peptide directed towards the N terminal of human VDAC2. Peptide sequence MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VDAC2 Antibody

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065] - WB Suggested Anti-VDAC2 Antibody Titration: 1.6 ug/ml Positive Control: human cell lines
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic
Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065] - VDAC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T

Applications for VDAC2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VDAC2

Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Interacts with hexokinases. It is present in the outer mitochondrial membrane. There are 4 isoforms as result of alternative splicing. Expressed in all tissues examined. Consists mainly of membrane spanning sided beta sheets. Belongs to the eukaryotic mitochondrial porin family.

Alternate Names

FLJ23841, hVDAC2, Outer mitochondrial membrane protein porin 2, POR, VDAC-2, voltage-dependent anion channel 2, voltage-dependent anion-selective channel protein 2

Gene Symbol

VDAC2

UniProt

NP_003366 (Human)

Additional VDAC2 Products

Product Documents for VDAC2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for VDAC2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.