WIPF1/WIP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09961

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09961-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all WIPF1/WIP Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WIPF1/WIP (NP_001070737.1). Peptide sequence PFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WIPF1/WIP Antibody

Western Blot: WIPF1/WIP Antibody [NBP3-09961]

Western Blot: WIPF1/WIP Antibody [NBP3-09961]

Western Blot: WIPF1/WIP Antibody [NBP3-09961] - Western blot analysis of WIPF1/WIP in Human HCT116Â Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for WIPF1/WIP Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WIPF1/WIP

WIPF1 is involved in the organization of the actin cytoskeleton. The protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these WIPF1 and Wiskott-Aldrich syndrome protein may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. WIPF1 binds to Wiskott-Aldrich syndrome protein, profilin and actin. It is involved with NCK1 and GRB2 in the recruitment and activation of N-WASP and may be involved in regulating the subcellular localization of N-WASP, resulting in the disassembly of stress fibers in filopodia formation.

Alternate Names

WAS/WASL interacting protein family, member 1, WAS/WASL-interacting protein family member 1, WASP-interacting protein, WASPIP, WIPMGC111041, WiskProtein PRPL-2, WiskPRPL-2

Gene Symbol

WIPF1

Additional WIPF1/WIP Products

Product Documents for WIPF1/WIP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for WIPF1/WIP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.