Zinc finger protein 581 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94501
![Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94501-img0001.jpg "Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1). MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Zinc finger protein 581 Antibody - Azide and BSA Free
![Western Blot: Zinc finger protein 581 AntibodyAzide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Western-Blot-NBP2-94501-img0007.jpg "Western Blot: Zinc finger protein 581 AntibodyAzide and BSA Free [NBP2-94501]")
Western Blot: Zinc finger protein 581 AntibodyAzide and BSA Free [NBP2-94501]
Western Blot: Zinc finger protein 581 Antibody [NBP2-94501] - Analysis of extracts of various cell lines, using Zinc finger protein 581 . Exposure time: 90s.![Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94501-img0003.jpg "Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]
Immunocytochemistry/Immunofluorescence: Zinc finger protein 581 Antibody [NBP2-94501] - Analysis of U-2 OS cells using Zinc finger protein 581 . Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunohistochemistry-Paraffin-NBP2-94501-img0006.jpg "Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]
Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody [NBP2-94501] - Paraffin-embedded rat pancreas using Zinc finger protein 581 .![Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94501-img0002.jpg "Immunocytochemistry/ Immunofluorescence: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
![Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunohistochemistry-Paraffin-NBP2-94501-img0004.jpg "Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
![Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]](https://resources.bio-techne.com/images/products/Zinc-finger-protein-581-Antibody-Immunohistochemistry-Paraffin-NBP2-94501-img0005.jpg "Immunohistochemistry-Paraffin: Zinc finger protein 581 Antibody - Azide and BSA Free [NBP2-94501]")
Applications for Zinc finger protein 581 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Western Blot
1:1000-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Zinc finger protein 581
Alternate Names
FLJ22550, HSPC189, zinc finger protein 581
Gene Symbol
ZNF581
Additional Zinc finger protein 581 Products
Product Documents for Zinc finger protein 581 Antibody - Azide and BSA Free
Product Specific Notices for Zinc finger protein 581 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov