ZNF384 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94454

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-94454-0.02ml
NBP2-94454-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all ZNF384 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1). MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF384 Antibody - Azide and BSA Free

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 Antibody [NBP2-94454] - Western blot analysis of extracts of HeLa cells, using ZNF384 antibody (NBP2-94454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody - Azide and BSA Free [NBP2-94454]

Immunohistochemistry-Paraffin: ZNF384 Antibody [NBP2-94454] - Immunohistochemistry of paraffin-embedded rat testis using ZNF384 Rabbit pAb (NBP2-94454) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 AntibodyAzide and BSA Free [NBP2-94454]

Western Blot: ZNF384 Antibody [NBP2-94454] - Western blot analysis of extracts of Rat thymus, using ZNF384 antibody (NBP2-94454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
View 2 more images

Applications for ZNF384 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF384

The ZNF384 gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functionsas a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The proteinappears to bind an

Alternate Names

CAG repeat protein 1, CAG/CTG 2, Cas-interacting zinc finger protein, zinc finger protein 384

Gene Symbol

ZNF384

Additional ZNF384 Products

Product Documents for ZNF384 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ZNF384 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.