Skip to main content

ABCA13 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57346PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57346PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA13.

Source: E. coli

Amino Acid Sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57346.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57346PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ABCA13

In human, the ATP-binding cassette (ABC) family of transmembrane transporters has at least 48 genes and 7 genesubfamilies. This gene is a member of ABC gene subfamily A (ABCA). Genes within the ABCA family typically encodeseveral thousand amino acids. Like other ABC transmembrane transporter proteins, this protein has 12 or moretransmembrane alpha-helix domains that likely arrange to form a single central chamber with multiple substrate bindingsites. It is also predicted to have two large extracellular domains and two nucleotide binding domains as is typicalfor ABCA proteins. Alternative splice variants have been described but their biological validity has not beendemonstrated.

Long Name

ATP Binding Cassette Subfamily A Member 13

Alternate Names

ATP binding cassette transporter A13, ATP-binding cassette sub-family A member 13, ATP-binding cassette, sub-family A (ABC1), member 13, DKFZp313D2411, EC 2.7.11.25, EC 3.6.3, FLJ16398, FLJ33876, FLJ33951

Gene Symbol

ABCA13

Additional ABCA13 Products

Product Documents for ABCA13 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA13 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...