Abhd5 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84506PEP
Key Product Details
Source
E. coli
Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABHD5.
Source: E. coli
Amino Acid Sequence: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84506.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP1-84506PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Abhd5
ABHD5 is a lysophosphatidic acid acyltransferase with a role in phosphatidic acid biosynthesis. ABHD5 may also help regulate cellular storage of triacylglycerol by activating the phospholipase PNPLA2. Additionaly, the ABHD5 protein is thought to play a role in keratinocyte differentiation.
Mutations in this gene are associated with Chanarin-Dorfman syndrome, a triglyceride storage disease characterized by impaired oxidation of long-chain fatty acids. Abhd5 is expressed in many tissues, including brain, liver, skin, skeletal muscle and lymphocytes.
Alternate Names
abhydrolase domain containing 5, Abhydrolase domain-containing protein 5,1-acylglycerol-3-phosphate O-acyltransferase ABHD5, CDS, CGI58, EC 2.3.1.51, IECN2, Lipid droplet-binding protein CGI-58, MGC8731, NCIE2CGI-58
Gene Symbol
ABHD5
Additional Abhd5 Products
Product Documents for Abhd5 Recombinant Protein Antigen
Product Specific Notices for Abhd5 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...