Skip to main content

ACSL1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89271PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89271PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSL1.

Source: E. coli

Amino Acid Sequence: YATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89271.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89271PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ACSL1

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Alternate Names

ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1

Gene Symbol

ACSL1

Additional ACSL1 Products

Product Documents for ACSL1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACSL1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...