Skip to main content

ADAM11 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-62689PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-62689PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM11.

Source: E. coli

Amino Acid Sequence: LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62689.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-62689PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ADAM11

ADAM11, or Disintegrin and metalloproteinase domain-containing protein 11, contains a long 83 kDa isoform and a short 58 kDa isoform, and is involved in an assortment of biological processes consisting of cell-cell or cell-matrix interactions. Disease research is currently being studied with ADAM11 and its relation to breast, pancreatic, and prostate cancer, as well as pancreatitis, prostatitis, neuronitis, and alcoholism. This protein has been linked to the integrin-mediated signaling pathway where it interacts with STC2 and YWHAB.

Alternate Names

a disintegrin and metalloproteinase domain 11, ADAM metallopeptidase domain 11, disintegrin and metalloproteinase domain-containing protein 11, MDCADAM 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

Gene Symbol

ADAM11

Additional ADAM11 Products

Product Documents for ADAM11 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ADAM11 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...