Skip to main content

AGXT2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89199PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89199PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2.

Source: E. coli

Amino Acid Sequence: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89199.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89199PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AGXT2

AGXT2, also known as Alanin-glyoxylate aminotransferase 2, consists of a 524 amino acid isoform that is 57 kDa, and is involved in the conversion of glyoxylate to glycine, the digestion of asymmetric dimethylarginine, and the regulation of blood pressure. Current research is being conducted on AGXT2 and its relation to mycobacterium tuberculosis and primary hyperoxaluria. This protein is included in the pathways of nucleotide and pyrimidine metabolism where it interacts with AGXT, ALAS2, GATM, GCAT, and GLDC.

Alternate Names

(R)-3-amino-2-methylpropionate--pyruvate transaminase, AGT 2, alanine-glyoxylate aminotransferase 2, alanine--glyoxylate aminotransferase 2, Beta-ALAAT II, Beta-alanine-pyruvate aminotransferase, DAIBAT, D-AIBAT, EC 2.6.1.40, EC 2.6.1.44, mitochondrial

Gene Symbol

AGXT2

Additional AGXT2 Products

Product Documents for AGXT2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AGXT2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...