Skip to main content

alcohol dehydrogenase 1A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46861PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-46861PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADH1A.

Source: E. coli

Amino Acid Sequence: IPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46861.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-46861PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 1A

This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.

Alternate Names

ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH1A

Additional alcohol dehydrogenase 1A Products

Product Documents for alcohol dehydrogenase 1A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for alcohol dehydrogenase 1A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...