Recombinant Human APOBEC3F GST (N-Term) Protein

Name: Recombinant Human APOBEC3F GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00200316-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00200316-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all APOBEC3F Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human APOBEC3F

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

38.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human APOBEC3F GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00200316-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: APOBEC3F

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Alternate Names

apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, ARP8, BK150C2.4.MRNA, DNA dC->dU-editing enzyme APOBEC-3F, EC 3.5.4, EC 3.5.4.-, induced upon T-cell activation, KA6, MGC74891

Gene Symbol

APOBEC3F

Additional APOBEC3F Products

Product Documents for Recombinant Human APOBEC3F GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human APOBEC3F GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews