Skip to main content

ASK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56971PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56971PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASK1.

Source: E. coli

Amino Acid Sequence: DEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56971.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56971PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ASK1

Apoptosis signal-regulating kinase-1 (ASK1, MEKK5, MAPKKK5) is a MAP3k type protein kinase belonging to mitogen-activated protein kinase kinase kinase (MAPKKK) family. As a regulator of JNK and p38 MAPK signaling pathways, ASK1/MEKK5 phosphorylates MMK4 to activate c-Jun N-terminal kinase (JNK) and phosphorylates MEK3 and MKK6 to activate p38. ASK1/MEKK5 is activated by oxidative stress, TNF via TRAF2, Fas via Daxx, calcium overload, and endoplasmic reticulum stress (1). ASK1/MEKK5 is inactivated by Trx, Grx, 14-3-3, and protein serine/threonine phosphatase 5 (2). While elevated level of ASK1/MEKK5 can induce apoptosis, a catalytically inactive ASK1/MEKK5 acts as an inhibitor in TNF-alpha induced apoptosis. Over-expression of ASK1/MEKK5 has also been implicated in cell differentiation, such as in keratinocyte differentiation through p38 pathway (3). ASK1/MEKK5 has been implicated as a therapeutic target for neurodegenerative disorder sand cardiac dysfunction (4).

Long Name

Apoptosis Signal-regulated Kinase 1

Alternate Names

MAP3K5, MEKK5

Gene Symbol

MAP3K5

Additional ASK1 Products

Product Documents for ASK1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ASK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...