ATP5O Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32602PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32602PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all ATP5O Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP5O.

Source: E. coli

Amino Acid Sequence: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32602.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32602PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ATP5O

ATP5O is a 213 amino acid F-type ATPase protein that is involved in producing ATP from ADP in the mitochondrial membrane when a proton gradient has been established across the membrane through the movement of charges across an electron transport complex in the respiratory chain. Current research is being performed on several diseases and disorders including graves disease, hashimotos thyroiditis, hypothyroidism, autoimmunity, goiter, diabetes mellitus, Huntington's disease, stomach cancer, osteoporosis, Parkinsons, twinning, osteosarcoma, hepatitis, and malaria. This protein has also been shown to have interactions with ATP5A1, ATP5B, ATP5D, IKBKG, and MPG in pathways such as the oxidative phosphorylation, metabolic, citric acid cycle (TCA), and Alzheimer's pathways.

Alternate Names

ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit, human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial, Oligomycin sensitivity conferral protein, oligomycin sensitivity conferring protein, OSCPhuman ATP synthase OSCP subunit

Gene Symbol

ATP5PO

Additional ATP5O Products

Product Documents for ATP5O Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP5O Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.