Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00003284-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot
Product Specifications
Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-372 of Human HSD3B2
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
68.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images
![SDS-PAGE: Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein [H00003284-P01]](https://resources.bio-techne.com/images/products/qc_test-H00003284-P01-1.jpg "SDS-PAGE: Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein [H00003284-P01]")
SDS-PAGE: Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein [H00003284-P01]
SDS-Page: Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein [H00003284-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00003284-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: Beta Hydroxysteroid Dehydrogenase
Alternate Names
3 beta-HSD type II, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, delta 5-delta 4-isomerase type II, HSD3B, HSDB, HSDB3B, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase, progesterone reductase, SDR11E2, short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase
Gene Symbol
HSD3B2
Additional Beta Hydroxysteroid Dehydrogenase Products
Product Specific Notices
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...