Calpain 6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88214PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88214PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Calpain 6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Calpain 6.

Source: E. coli

Amino Acid Sequence: TLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88214.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88214PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Calpain 6

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins areheterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses acysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated inneurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The proteinencoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to thecalmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to beproteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promotingangiogenesis. (provided by RefSeq)

Alternate Names

calpain 6, calpain-6, Calpain-like protease X-linked, Calpamodulin, CalpMCALPM, CANPXcalpamodulin, CAPNX, DJ914P14.1, EC 3.4.22

Gene Symbol

CAPN6

Additional Calpain 6 Products

Product Documents for Calpain 6 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Calpain 6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.