CBX4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55246PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55246PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all CBX4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBX4.

Source: E. coli

Amino Acid Sequence: SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55246.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55246PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CBX4

PC2 is the human homolog of the Drosophila 'Polycomb' (Pc) protein which has been identified as a gene family member associated with a cellular memory system that is responsible for the inheritance of gene activity by progeny cells. The human Pc homolog gene is more closely related to a Xenopus Pc homolog, XPc, than to a previously described human Pc homolog, CBX2 (hPc1). However, the hPc2 and CBX2/hPc1 proteins are shown to colocalize in interphase nuclei of human U-2 OS osteosarcoma cells, suggesting that the proteins are part of a common protein complex. The human protein is believed to function as a repressor of proto-oncogene activity and that interference with hPc2 function can lead to derepression of proto-oncogene transcription and subsequently to cellular transformation. Other reports describe PC2 as a protein that has SUMO E3 activity for the corepressors CtBP and CtBP2.

Alternate Names

chromobox homolog 4, chromobox homolog 4 (Drosophila Pc class), Chromobox protein homolog 4, Drosophila), E3 SUMO-protein ligase CBX4, hPc2, NS5ATP1-binding protein 16, Pc class 2 homolog, PC2, Polycomb 2 homolog

Gene Symbol

CBX4

Additional CBX4 Products

Product Documents for CBX4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CBX4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.