Skip to main content

CEACAM7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-39098PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-39098PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEACAM7.

Source: E. coli

Amino Acid Sequence: RVHANYRIIGYVKNISQENAPGPAHNGRET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39098.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-39098PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CEACAM-7

CEACAM-7 (carcinoembryonic antigen cell adhesion molecule 7; also CGM2) is a 40 - 45 kDa member of the CEACAM subfamily of the CEA family of proteins. It has a restricted expression pattern, being found on epithelium of the colon, appendix and pancreatic ducts. CEACAM-7 is markedly down-regulated in colon carcinoma. Mature human CEACAM-7 is a 209 amino acid (aa), GPI-linked glycoprotein. It contains one V-type (aa 36 - 142) and one C2-type (aa 146 - 233) Ig-like domain, plus a 21 aa C-terminal propeptide. One alternate splice form of CEACAM-7 exists that shows a deletion of aa 143 - 235. No definitive rodent CEACAM-7 has been reported.

Long Name

Carcinoembryonic Antigen-related Cell Adhesion Molecule 7

Alternate Names

CEACAM7, CGM2

Gene Symbol

CEACAM7

Additional CEACAM-7 Products

Product Documents for CEACAM7 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CEACAM7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...