CHIP/STUB1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47510PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-47510PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CHIP/STUB1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STUB1.

Source: E. coli

Amino Acid Sequence: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47510.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47510PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CHIP/STUB1

STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.

Long Name

C-terminus of Hsc70 Interacting Protein

Alternate Names

HSPABP2, NY-CO-7, SDCCAG7, STUB1, UBOX1

Gene Symbol

STUB1

Additional CHIP/STUB1 Products

Product Documents for CHIP/STUB1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CHIP/STUB1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.