Cholecystokinin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-62664PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-62664PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CCK Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cholecystokinin.

Source: E. coli

Amino Acid Sequence: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62664.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-62664PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CCK

The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.

Long Name

Cholecystokinin

Alternate Names

cholecystokinin, MGC117187

Gene Symbol

CCK

Additional CCK Products

Product Documents for Cholecystokinin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cholecystokinin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.