Recombinant Human COP GST (N-Term) Protein

Name: Recombinant Human COP GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00114769-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00114769-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all COP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-97 of Human COP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human COP GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00114769-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: COP

Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of theproteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release ofIL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokineresponse. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, andstaurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspasesCASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2

Alternate Names

CARD only domain-containing protein 1, CARD only protein, caspase recruitment domain family, member 16, Caspase-1 inhibitor COP, COP1caspase-1 dominant-negative inhibitor pseudo-ICE, COPcaspase recruitment domain-containing protein 16, EC 3.4.22.36, Pseudo interleukin-1 beta converting enzyme, pseudo interleukin-1beta converting enzyme, Pseudo-ICE

Gene Symbol

CARD16

Additional COP Products

Product Documents for Recombinant Human COP GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human COP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews