CXCR7/RDC-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58162PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58162PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CXCR7/RDC-1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CXCR7.

Source: E. coli

Amino Acid Sequence: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58162.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58162PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CXCR7/RDC-1

CXCR7/RDC-1 is a G protein-coupled receptor (GPCR) member of the CXC subfamily of chemokine receptors. Human CXCR7/RDC-1 is 362 amino acids (aa) in length with a predicted molecular weight of 41 kDa. Mouse and rat CXCR7/RDC-1 share 93% aa sequence identity with the human protein. CXCR7/RDC-1 binds to and acts as a scavenger for CXCL11/I-TAC and CXCL12/SDF-1. CXCR7/RDC-1 can also function as a co-receptor for HIV and SIV. Unlike other chemokine receptors, CXCR7/RDC-1 does not activate G protein signaling, but instead initiates beta-Arrestin-mediated receptor-ligand internalization. Although CXCR7/RDC-1 itself does not activate G protein signaling, the receptor can heterodimerize with CXCR4 to activate G proteins in response to CXCL12/SDF-1 binding. Studies on CXCR7/RDC-1 knockout mice suggest that it is critical for cardiovascular development. While CXCR7/RDC-1 does not appear to signal in normal hematopoietic cells, it is highly expressed in leukemic cells where it activates Akt signaling that promotes cell trafficking and adhesion. CXCR7/RDC-1 also mediates neuronal migration, displays aberrant signaling in astrocytes, and is highly expressed in glioma cells.

Alternate Names

ACKR3, CMKOR1, CXCR7, GPR159, RDC-1

Gene Symbol

ACKR3

Additional CXCR7/RDC-1 Products

Product Documents for CXCR7/RDC-1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CXCR7/RDC-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.