Skip to main content

Cyclin B2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89657PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89657PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCNB2.

Source: E. coli

Amino Acid Sequence: TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89657PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Cyclin B2

Cyclin B2 (also CCNB2 and G2/mitotic-specific cyclin-B2) is a 45-46 kDa member of the Cyclin AB subfamily, cyclin family of proteins. It is widely expressed and associates with CDK1 providing substrate specificity to a phosphorylating complex. A phosphorCDK1:Cyclin B2 complex is associated with the Golgi apparatus, where it contributes to Golgi fragmentation during mitosis. It is also possible that Cyclin B2 can substitute for Cyclin B1 during the early stages of mitosis. Human Cyclin B2 is 398 amino acids (aa) in length. It contains two cyclin box folds (aa 201-290 and 298-383) and two substrate binding sites (aa 165-254 and 264-347). Phosphorylation occurs at Ser92, Thr94, Ser99, Ser204, Ser392 and Ser398. Over aa 1-101, human Cyclin B2 shares 79% aa identity with mouse Cyclin B2.

Alternate Names

CCNB2

Gene Symbol

CCNB2

Additional Cyclin B2 Products

Product Documents for Cyclin B2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cyclin B2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...