Skip to main content

Cyclophilin A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46850PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-46850PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIA.

Source: E. coli

Amino Acid Sequence: FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46850.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-46850PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Cyclophilin A

Cyclophilin A, also known as Peptidylprolyl Isomerase A, PPIA, CYPA, and CYPH, was originally characterized for its ability to catalyze the transition between cis and trans proline residues critical for proper folding of proteins. Ubiquitously expressed, Cyclophilin A has a predicted molecular weight of 17 kDa and is proinflammatory cytokine that is secreted in response to inflammatory stimuli. Human Cyclophilin A shares 95% amino acid identity with both the mouse and rat orthologs. Cyclophilin A is the main target of the immunosuppressive drug Cyclosporin A. The immunosuppressive activity of cyclosporins has been correlated with their ability to form complexes with cyclophilins that inhibit Calcineurin Phosphatase activity and prevent incorporation of Cyclophilin A into viral particles. Cyclophilin A is known to be incorporated into many viruses, including HIV1 and Hepatitis C, where it may be involved in functions such as viral assembly, replication, and infectivity. In addition, Cyclophilin A has been shown to promote atherosclerosis via binding to Extracellular matrix metalloproteinase (MMP) inducer (EMMPRIN) on CD34+ progenitor cells and stimulating differentiation to foam cells, an essential step during atherosclerotic plaque formation in blood vessels. Cyclophilin A-induced disruption of blood-brain barrier function is thought to contribute to the increased risk of developing Alzheimer’s disease in individuals that possess one or two Apolipoprotein E4 alleles.

Alternate Names

CYPA, CYPH, PPIA, Rotamase

Gene Symbol

PPIA

Additional Cyclophilin A Products

Product Documents for Cyclophilin A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cyclophilin A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...