DEC2/SHARP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17786PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-17786PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all DEC2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEC2/SHARP1

Source: E. coli

Amino Acid Sequence: GQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17786.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17786PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DEC2

Human DEC1 is a 412 amino acid, basic helix-loop-helix (bHLH) containing protein that is involved in the control of proliferation and/or differentiation of several cell types including nerve cells, fibroblasts and chondrocytes. The bHLH region of DEC1 is structurally similar to the bHLH regions of the mammalian HES family, Drosophila hairy, and Enhancer of split m7. DEC1 is a novel direct target for cAMP in a wide range of cells, and is involved in the control of gene expression in cAMP-activated cells. DEC2, also known as SHARP1, is highly expressed in skeletal muscle and brain. The gene encoding human DEC2 maps to chromosome 12p11.23-p12.1. DEC1 and DEC2 play a role in regulating the mammalian molecular clock by suppressing the transcription of specific clock genes. Both DEC1 and DEC2 are detected in the suprachiasmimc nucleus in a circadian fashion. Brief light impulses induce the expression of DEC1 in a phase-dependent manner.

Long Name

Differentially expressed in chondrocytes protein 2

Alternate Names

BHLHB3, BHLHE41, SHARP-1

Gene Symbol

BHLHE41

Additional DEC2 Products

Product Documents for DEC2/SHARP1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DEC2/SHARP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.