Skip to main content

DGCR14 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84257PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84257PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DGCR14.

Source: E. coli

Amino Acid Sequence: LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84257.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84257PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DGCR14

DGCR14, also known as DiGeorge syndrome critical region 14, is a 52.6 kDa, 476 amino acid protein that exists in the region thought to be responsible for multiple developmental disorders. Current research is studying the involvement of the protein in diseases and disorders such as DiGeorge syndrome, schizophrenia, velocardiofacial syndrome, and faces syndrome. The protein may be involved in mRNA splicing pathways where it interacts with PFDN1, VIM, TTC14, GNB2L1, and FRA10AC1.

Alternate Names

DGCR13, DGS-HDGS-I, DGSIDGSH, DiGeorge syndrome critical region 13, DiGeorge syndrome critical region 14, DiGeorge syndrome critical region gene 13, DiGeorge syndrome critical region gene 14, DiGeorge syndrome gene H, DiGeorge syndrome gene I, DiGeorge syndrome protein H, ES2DiGeorge syndrome critical region gene DGSI, Es2el, Protein DGCR13, protein DGCR14, Protein ES2

Gene Symbol

ESS2

Additional DGCR14 Products

Product Documents for DGCR14 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DGCR14 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...