Recombinant Human DNAJC2 GST (N-Term) Protein

Name: Recombinant Human DNAJC2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00027000-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00027000-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all DNAJC2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human ZRF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKGSPGDSYQKLILQLIHLMKCYLIQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

45.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DNAJC2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00027000-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: DNAJC2

This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. [provided by RefSeq]

Alternate Names

DnaJ (Hsp40) homolog, subfamily C, member 2, dnaJ homolog subfamily C member 2, MPHOSPH11M-phase phosphoprotein 11, MPP11Zuotin-related factor 1, ZRF1zuotin, ZUO1, zuotin related factor 1

Gene Symbol

DNAJC2

Additional DNAJC2 Products

Product Documents for Recombinant Human DNAJC2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human DNAJC2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews