Recombinant Human Dopamine D2R/DRD2 Protein

Name: Recombinant Human Dopamine D2R/DRD2 Protein
Brand: Novus Biologicals
SKU: H00001813-G01

Novus Biologicals, part of Bio-Techne | Catalog # H00001813-G01

Submit a review

Product Datasheet / COA

100% Guarantee

Technical Data
Citations & Reviews

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

View all Dopamine D2 R/DRD2 Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (ABM82846.1) for Human Dopamine D2 R/DRD2

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

48.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00001813-G01

Preparation Method	in vitro wheat germ expression system with proprietary liposome technology
Formulation	25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative	Glycerol
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Dopamine D2 R/DRD2

The DRD2 Dopamine Receptor is involved in the neuromodulation of appetitive behaviors. DRD2 may be linked to alcoholism and other substance-use disorders. Mutations in DRD2 in mice lead to the suppression of reward behavior with morphine and to the reduction of spontaneous movements, a phenotype resembling Parkinson's disease. Three alternatively spliced isoforms have been identified. DRD2 has been reported to be expressed in various regions of the brain, as well as in aorta, artery, eye, and spinal cord. ESTs have been isolated from normal pituitary and in brain, colon, lung, pancreas, and skeletal muscle cancer libraries.

Long Name

Dopamine D2 Receptor

Alternate Names

D2DR, D2R, Dopamine D2R, DRD2

Gene Symbol

DRD2

Additional Dopamine D2 R/DRD2 Products

Product Documents for Recombinant Human Dopamine D2R/DRD2 Protein

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for Recombinant Human Dopamine D2R/DRD2 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews