Skip to main content

Dystroglycan Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17837PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17837PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dystroglycan

Source: E. coli

Amino Acid Sequence: WENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17837.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17837PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Dystroglycan

Dystroglycan (also known as dystrophin-associated glycoprotein 1) is a member of the dystroglycan family that contains the WWW binding motif PPxY. This protein has alpha and beta subunits with approximate molecular weights of 156 kD and 43-50 kD, respectively. The dystroglycan beta subunit is an integral membrane protein, the alpha subunit is a ubiquitously expressed extracellular protein. Muscle and non-muscle isoforms differ by carbohydrate moieties (not protein sequence). Dystroglycan functions as an adhesion molecule responsible for interactions between extracellular matrix and the subsarcolemmal cytoskeleton. Dsytroglycan binds to lamin in the matrix and dystrophin in the cytoskeleton; phosphorylation regulates the association of interacting proteins. Dystroglycan binds to utrophin when unphosphorylated; c-Src, Fyn, Csk, NCK, and SHC when phosphorylated. Dystroglycan interacts with dystrophin through the WW domain. The Poly6171 antibody recognizes human phosphorylated dystroglycan (Tyr893) and has been shown to be useful for Western blotting.

Long Name

Dystrophin-associated Glycoprotein 1

Alternate Names

AGRNR, Dag-1, DAG1

Gene Symbol

DAG1

Additional Dystroglycan Products

Product Documents for Dystroglycan Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Dystroglycan Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...