EDA/Ectodysplasin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55217PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55217PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all EDA/Ectodysplasin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDA/Ectodysplasin.

Source: E. coli

Amino Acid Sequence: YYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55217.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55217PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EDA/Ectodysplasin

Ectodysplasin (EDA) is a type II transmembrane protein belonging to the TNF superfamily. It can be expressed as eight alternatively spliced isoforms that are encoded by the EDA gene. Isoforms of EDA are expressed in cells of ectodermal origin, where they are localized to the cell surface and can be released in a soluble form following cleavage by Furin. The EDA-A1 and EDA-A2 splice variants differ by the deletion of two amino acids in the extracellular domain of EDA-A2. Despite this minor difference, EDA-A1 and EDA-A2 display strong receptor specificity. EDA-A1 binds to EDAR, whereas EDA-A2 binds to XEDAR. EDA-A1 and EDA-A2 are required during development, and loss or mutation of EDA results in abnormal development of hair follicles, sweat glands, and teeth. Mutations in the EDA gene are associated with a group of developmental disorders identified as ectodermal dysplasia type 1.

Alternate Names

Tabby, XHED, XLHED

Gene Symbol

EDA

Additional EDA/Ectodysplasin Products

Product Documents for EDA/Ectodysplasin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EDA/Ectodysplasin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.