Skip to main content

EHF Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56705PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56705PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EHF.

Source: E. coli

Amino Acid Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56705.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56705PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EHF

ETS homologous factor (ETS), also known as ETS domain-containing transcription factor, epithelium-specific ETS transcription factor 3, EHF, ESE3, ESE3B, and ESEJ, is a member of the ETS family. This family is characterized by epithelial-specific expression (ESEs). ETS acts as a transcriptional repressor for a specific subset of ETS/AP-1 responsive genes and a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. As such, ETS may play a role in epithelial differentiation and carcinogenesis. ETS is also involved in TNFRSF10B/DR5 regulation through the ETS-binding sequences on the TNFRSF10B/DR5 promoter.

Alternate Names

Epithelium-specific Ets transcription factor 3, ESE-3, ESE3 transcription factor, ESE3B, ESE3hEHF, ESEJepithelium-specific ets factor 3, ETS domain-containing transcription factor, ets homologous factor

Gene Symbol

EHF

Additional EHF Products

Product Documents for EHF Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EHF Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...