Skip to main content

EIF3A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84875PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84875PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3A.

Source: E. coli

Amino Acid Sequence: PENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84875.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84875PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EIF3A

Eukaryotic initiation factor 3 subunit A (eIF3A) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3A is also known as EIF3S10 (eukaryotic initiation factor 3 subunit 7). eIF3A is the largest subunit of the eIF3 complex. eIF3A expression is regulated through the cell cycle. It's expression peaks in S-phase and it is proposed to play a role in regulating the translation of mRNAs involved in the regulation of cell cycle progression and proliferation. Alternative names for eIF3A include eIF-3-theta, eIF-3 p167, eIF-3 p170, eIF-3 p180, eIF3-p185, EIF3S10, and KIAA0139.

Alternate Names

centrosomin homolog, cytoplasmic protein p167, eIF3 p167, eIF3 p180, eIF3 p185, EIF3, p180 subunit, eIF3a, eIF3-p170, EIF3S10EIF3, eIF-3-theta, eIF3-theta, Eukaryotic translation initiation factor 3 subunit 10, eukaryotic translation initiation factor 3 subunit A, eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD), eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD), eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa, eukaryotic translation initiation factor 3, subunit 10, 170kD, eukaryotic translation initiation factor 3, subunit A, KIAA0139P167, p180, p185, TIF32

Gene Symbol

EIF3A

Additional EIF3A Products

Product Documents for EIF3A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EIF3A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...