Recombinant Human EIF3G GST (N-Term) Protein

Name: Recombinant Human EIF3G GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00008666-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00008666-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all EIF3G Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 221-320 of Human EIF3G

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human EIF3G GST (N-Term) Protein

SDS-PAGE: Recombinant Human EIF3G GST (N-Term) Protein [H00008666-Q01]

SDS-Page: Recombinant Human EIF3G Protein [H00008666-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00008666-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: EIF3G

Eukaryotic initiation factor 3 subunit G (eIF3G) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3G has been shown to directly interact with AIF (apoptosis inducing factor), a protein that plays a role in caspase-independent apoptosis. AIF is able to inhibit protein synthesis via its interaction with eIF3g.

Alternate Names

eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G

Gene Symbol

EIF3G

Additional EIF3G Products

Product Documents for Recombinant Human EIF3G GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human EIF3G GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews