Recombinant Human EMP2 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00002013-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, Western Blot
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human EMP2
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
45.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Reviewed Applications
Read 2 reviews rated 5 using H00002013-P01 in the following applications:
Scientific Data Images for Recombinant Human EMP2 GST (N-Term) Protein
![Western Blot: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]](https://resources.bio-techne.com/images/products/EMP2-Recombinant-Protein-Western-Blot-H00002013-P01-img0001.jpg "Western Blot: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]")
Western Blot: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]
Western Blot: EMP2 Recombinant Protein [H00002013-P01] - analysis of EMP2 using anti-EMP2 antibody (Cat.# NBP1-86847). The EMP2 recombinant protein was used as a positive control. Image from verified customer review.
12.5% SDS-PAGE Stained with Coomassie Blue.
![ELISA: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]](https://resources.bio-techne.com/images/products/EMP2-Recombinant-Protein-ELISA-H00002013-P01-img0002.jpg "ELISA: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]")
ELISA: Recombinant Human EMP2 GST (N-Term) Protein [H00002013-P01]
ELISA: EMP2 Recombinant Protein [H00002013-P01] - EMP2 recombinant protein coated into ELISA plate; used as a positive control for EMP2 antibody (Cat# NBP1-86847). Image from verified customer review.Formulation, Preparation and Storage
H00002013-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: EMP2
Long Name
Epithelial Membrane Protein 2
Alternate Names
XMP
Gene Symbol
EMP2
Additional EMP2 Products
Product Documents for Recombinant Human EMP2 GST (N-Term) Protein
Product Specific Notices for Recombinant Human EMP2 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...