Recombinant Human EMR3 Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00084658-G01
Key Product Details
Source
Wheat germ
Conjugate
Unconjugated
Applications
Affinity Purification
Product Specifications
Description
An untagged recombinant protein corresponding to the amino acid sequence of (Q9BY15) for Human EMR3
Source: Wheat Germ (in vitro) with proprietary liposome technology
Amino Acid Sequence: MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
72.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Formulation, Preparation and Storage
H00084658-G01
| Preparation Method | in vitro wheat germ expression system with proprietary liposome technology |
| Formulation | 25 mM Tris-HCl pH8.0 in 2% glycerol. |
| Preservative | Glycerol |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: EMR3
Long Name
EGF-like Module Containing, Mucin-like, Hormone Receptor-like 3
Alternate Names
egf-like module containing, mucin-like, hormone receptor-like 3, EGF-like module receptor 3, EGF-like module-containing mucin-like hormone receptor-like 3, egf-like module-containing mucin-like receptor 3
Gene Symbol
ADGRE3
Additional EMR3 Products
Product Documents for Recombinant Human EMR3 Protein
Product Specific Notices for Recombinant Human EMR3 Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...