Recombinant Human Gelsolin/GSN GST (N-Term) Protein

Name: Recombinant Human Gelsolin/GSN GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002934-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00002934-Q01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Gelsolin/GSN Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (AAH26033) for Human Gelsolin/GSN

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Gelsolin/GSN GST (N-Term) Protein

SDS-PAGE: Recombinant Human Gelsolin/GSN GST (N-Term) Protein [H00002934-Q01]

SDS-Page: Gelsolin/GSN Recombinant Protein [H00002934-Q01]

Formulation, Preparation and Storage

H00002934-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Gelsolin/GSN

Gelsolin is a calcium regulated actin binding protein. Gelsolin is a regulator of actin filament assembly and disassembly and consists of six homologous subdomains (S1-S6). When C-terminal tail (S6) is bound to calcium ion, it straightens and exposes actin binding sites located on S2s helices, leading to Gelsolin actin-serving activity (1). Gelsolin is inhibited by phosphatidylinositol (4,5)-bisphosphate (PIP2), where PIP2 will bind to S1, S2, and S3 sites. Gelsolin is involved in podosome formation and has been linked to inhibition of apoptosis by preventing release of cytochrome C (2).

Alternate Names

ADF, AGEL, Brevin, GSN

Gene Symbol

GSN

Additional Gelsolin/GSN Products

Product Documents for Recombinant Human Gelsolin/GSN GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Gelsolin/GSN GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews