Skip to main content

GKAP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33989PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33989PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GKAP1.

Source: E. coli

Amino Acid Sequence: ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33989.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33989PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GKAP1

The GKAP1 gene encodes a G kinase-anchoring protein 1 that is thought to be involved in germ cell development as it localizes with the Golgi and recruits cGMP-dependent protein kinase I alpha to the Golgi in the mouse tests. It exists in two isoforms with isoform 1 at a length of 366 amino acids at 42 kDA and isoform 2 is 315 amino acids long at 36 kDa. The GKAP1 gene has been known to interact with other genes FXR2, HBP1, HGS, PRKG1, and UBQLN4. It has been researched regarding its role in different diseases such as leukemia, ataxia, and pancreatitis.

Alternate Names

cGMP-dependent protein kinase-anchoring protein of 42 kDa, FKSG21, FLJ25469, G kinase anchoring protein 1, G kinase-anchoring protein 1, GKAP42cGMP-dependent protein kinase anchoring protein 42kDa, protein kinase anchoring protein GKAP42

Gene Symbol

GKAP1

Additional GKAP1 Products

Product Documents for GKAP1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GKAP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...