GPR37 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49540PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49540PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all GPR37 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR37.

Source: E. coli

Amino Acid Sequence: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49540.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49540PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GPR37

GPR37 is an Orphan-A GPCR with an unknown ligand. GPR37 was recently identified as the PAEL receptor, a Parkin substrate involved in autosomal recessive juvenile Parkinson's (PDJ) disease. The PAEL receptor becomes unfolded, insoluble, and ubiquitinated when overexpressed, leading to unfolded protein-induced cell death. When the PAEL receptor is ubiquitinated by Parkin, it gets degraded, resulting in the suppression of cell death. The insoluble form of the PAEL receptor accumulates in the brains of PDJ patients and may cause selective neuronal death. GPR37 expression has been reported in brain, liver, and placenta. ESTs have been isolated from brain, embryo, eye, fetal lung/testis/Bcell, gallbladder, heart, liver, liver/spleen, melanocyte/uterus/fetal heart, nerve, placenta, testis, tonsil, and vessel libraries.

Long Name

G Protein-coupled Receptor 37

Alternate Names

ETBR-LP-1, PAELR

Gene Symbol

GPR37

Additional GPR37 Products

Product Documents for GPR37 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPR37 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.