Skip to main content

GPR50 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56258PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56258PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR50.

Source: E. coli

Amino Acid Sequence: PTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56258.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56258PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GPR50

GPR50, also known as MTR1L, is a nonglycosylated seven-transmembrane G protein-coupled receptor that is related to the melatonin receptors MT1 and MT2. GPR50 is expressed in the hippocampus, hypothalamus, and pituitary and forms 130 kDa homodimers. It heterodimerizes with either MT1 or MT2, resulting in inhibition of MT1 but not MT2 function. An alternately spliced isoform of GPR50 has a 4 aa deletion in the large C-terminal cytoplasmic domain. The presence of this deletion as well as various polymorphisms in GPR50 have been associated with elevated serum triglyceride and HDL levels. The deletion may also be associated with the development of bipolar disorder. Human GPR50 shares approximately 70% aa sequence identity with mouse and rat GPR50.

Long Name

G Protein-coupled Receptor 50

Alternate Names

H9, MTR1L

Gene Symbol

GPR50

Additional GPR50 Products

Product Documents for GPR50 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPR50 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...