Skip to main content

GPR98 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57048PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57048PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR98.

Source: E. coli

Amino Acid Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57048.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57048PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GPR98

GPR98, also known as Very Large G Protein-Coupled Receptor-1 (VLGR1), is an Orphan-A GPCR with an unknown ligand. VLGR1 consists of three expressed isoforms. VLGR1 has a large ectodomain containing multiple CALX-beta repeats that resemble regulatory domains of sodium-calcium exchanger proteins. VLGR1b, which is the only form expressed in mouse, is apparently the largest known cell-surface protein with an ectodomain containing 35 CALX- repeats and a pentraxin homology domain. The MASS1 gene, which is a fragment of the very large G-protein-coupled receptor VLGR1, is mutated in the Frings mouse model of audiogenic epilepsy. VLGR1 has been reported to be widely expressed in normal solid tissues. ESTs have been isolated from human adrenal, brain, colon, eye, kidney, nerve, and testis libraries.

Alternate Names

FEB4, G protein-coupled receptor 98, MASS1, USH2B, USH2C, VLGR1, VLGR1b

Gene Symbol

GPR98

Additional GPR98 Products

Product Documents for GPR98 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPR98 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...