Skip to main content

Granzyme K Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17052PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17052PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Granzyme K

Source: E. coli

Amino Acid Sequence: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17052PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Granzyme K

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Alternate Names

Fragmentin-3, Granzyme 3, Granzyme-K, GZMK, NK-Tryp-2, NK-Tryptase-2, TRYP2, Tryptase II

Gene Symbol

GZMK

Additional Granzyme K Products

Product Documents for Granzyme K Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Granzyme K Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...