GRK4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55415PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55415PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all GRK4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to GRK4.

Source: E. coli

Amino Acid Sequence: DKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKVFEECTRVAHNYLRGEPFEEYQESSYFSQFLQWKWLER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55415.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55415PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GRK4

A guanine nucleotide-binding protein (G Protein)-coupled receptor kinase subfamily, of the Ser/Thr protein kinase family, is encoded by the gene GRK4. There are a total of four isoforms of this gene: GRK4-alpha is 578 amino acids long at 66 kDA; GRK4-beta is 546 amino acids long at 63 kDA; GRK4-delta is 500 amino acids long at 57 kDA; and isoform 4, GRK4-gamma is 532 amino acids long at 61 kDA. GRK4-alpha is inhibited by caulmodulin and can phosphorylate rhodopsin, however the three other forms of GRK4 do not interact with calmodulin. GRK4 has been investigated in hypertension, breast cancer, aortic coarctation, and atherosclerosis. It participates in endocytosis and the chemokine signaling pathway through interactions with the CALM1, CALM2, CALM3, FSHR, and IKBKG genes.

Alternate Names

EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 2-like (Drosophila), G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2LIT11, GPRK4GRK4a, G-protein coupled receptor kinase 4, ITI1

Gene Symbol

GRK4

Additional GRK4 Products

Product Documents for GRK4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GRK4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.