hnRNP F Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57442PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57442PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all hnRNP F Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human hnRNP F.

Source: E. coli

Amino Acid Sequence: TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57442.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57442PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP F

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport, and also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. hnRNP complexes are the major constituents of the spliceosome and in particular, the hnRNP A1 protein is one of the major premRNA/ mRNA binding proteins and also one of the most abundant proteins in the nucleus. hnRNP A1 and A2/B1 regulate the processing of pre-mRNA by directly antagonizing the association of various splicing factors and by influencing the splice site selection on pre-mRNA. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. Most hnRNP proteins, including hnRNP C1 and C2, contain one or more RNA binding domains and are implicated in the processing of pre-mRNA. hnRNPs F and H are largely related factors that preferentially associate with poly(rG) regions on RNA. Isoforms of these proteins are often generated by alternative processing of the premRNA and by posttranslational modifications such as phosphorylation on serines and threonines and methylation of arginines.

Alternate Names

heterogeneous nuclear ribonucleoprotein F, hnRNP F, HNRPFHnRNP F protein, mcs94-1, MGC110997, Nucleolin-like protein mcs94-1, OK/SW-cl.23

Gene Symbol

HNRNPF

Additional hnRNP F Products

Product Documents for hnRNP F Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for hnRNP F Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.