HPRG Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33594PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33594PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all HPRG Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRG.

Source: E. coli

Amino Acid Sequence: HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33594.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33594PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HPRG

HRG, also known as Histidine-rich glycoprotein, is a 525 amino acid protein that is approx. 60 kDa, functions as plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions; acts as an adapter protein; mediates clearance of necrotic cells; inhibits the formation of insoluble immune complexes; ties plasminogen to the cell surface; binds T-cells and alters the cell morphology; modulates angiogenesis; inhibits endothelial cell motility; plays a role in the regulation of tumor angiogenesis and tumor immune surveillance; and normalizes tumor vessels and promotes antitumor immunity by polarizing tumor-associated macrophages. Studies on this protein have shown a relationship with thrombophilia, thrombophilia due to elevated hrg, thrombophilia due to hrg deficiency, protein c deficiency, myocardial infarction, acute myocardial infarction, corneal neovascularization, thrombosis, rheumatoid arthritis, hyperhomocysteinemia, arthritis, retinal vein occlusion, graft versus host disease, nephrotic syndrome, diabetes mellitus, cd3, twinning, retinitis, and hepatitis b. This protein has been shown to have interactions with C1QB, FGA, C1QA, FCGR1A, PLG, and THBS1 in the hemostasis, platelet degranulation, dissolution of fibrin clot, platelet activation, signaling and aggregation, and response to elevated platelet cytosolic Ca2+ pathways.

Long Name

Histidine-rich Glycoprotein Precusor

Alternate Names

HRG

Gene Symbol

HRG

Additional HPRG Products

Product Documents for HPRG Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HPRG Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.