HUNK Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14110PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14110PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all HUNK Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HUNK.

Source: E. coli

Amino Acid Sequence: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14110.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14110PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HUNK

HUNK, an AMPK/SNF1-type protein kinase, contains a domain homologous to SNF1, a protein involved in the response to nutritional stress in yeast. HUNK has been shown to participate in vesicular transport. Additionally, functional studies in mice suggest that HUNK regulates endocytosis via interaction with rabaptin-5 protein and induces changes in mammary glands during pregnancy. HUNK expression has been documented in mouse brain, breast, embryo, and fetus. ESTs have been isolated from several human tissue libraries, including normal ear.

Alternate Names

B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V

Gene Symbol

HUNK

Additional HUNK Products

Product Documents for HUNK Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HUNK Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.