IGFBP-6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86495PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86495PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all IGFBP-6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGFBP6.

Source: E. coli

Amino Acid Sequence: PGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86495.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86495PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IGFBP-6

Data show that an increase in JNK activation in the presence of NFkappaB inhibition significantly increased the expression of IGFBP6. These studies provide evidence that over expression of IGFBP-6 suppresses human and murine osteoblast differentiation, that IGFBP-6 and LMP-1 physically interact, and supports the conclusion that this interaction may be functionally relevant. IGFBP-6 is the effector of tumor suppressor activity of SEMA3B. Observational study of gene-disease association. (HuGE Navigator) IGFBP-6 is translocated to the nucleus with functional consequences, and different members of the IGFBP family have specific nuclear import mechanisms. Toxic effect of TCDD on osteogenesis through altering IGFBP6 gene expression in osteoblasts is reported. p38 MAPK is involved in IGFBP-6-induced IGF-independent rhabdomyosarcoma cell migration. determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation. Inhibition of human osteoblast marker gene expression by retinoids is mediated in part by insulin-like growth factor binding protein-6. A close correlation exists between residues of the carboxyl-terminal domain of IGFBP6 undergoing conformational change in 15N NMR spectroscopy studies with those that disappeared or broadened upon insulin-like growth factor (IGF-II) binding. C-domain of IGFBP-6 consists of a thyroglobulin type 1 fold comprising an alpha-helix followed by a loop, a three-stranded antiparallel beta-sheet incorporating a second loop, and a disulfide-bonded flexible third loop. The expression of certain IGFBP is significantly altered in renal cell carcinoma. CCI-779 acts additively with IGFBP-6 to reduce rhabdomyosarcoma growth both in vitro and in vivo. may function as an antiproliferative molecule suppressing mitogenic effects of insulin-like growth factors on Malassez cells. The IGFBP-6 protein is synthesized as propeptides with a hydrophobic leader sequence, removal of which yields a mature protein composed of 3 recognizable domains of similar size. transgenic human IGFBP-6 mice may be considered a new tool for studies of the involvement of the brain IGF system in metabolism control and obesity.

Long Name

Insulin-like Growth Factor Binding Protein 6

Alternate Names

IGFBP6

Gene Symbol

IGFBP6

Additional IGFBP-6 Products

Product Documents for IGFBP-6 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IGFBP-6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.