Recombinant Human IgG3 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00003502-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot
Product Specifications
Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-521 of Human IGHG3
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSDHYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSVHLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
83.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human IgG3 GST (N-Term) Protein
![SDS-PAGE: Recombinant Human IgG3 GST (N-Term) Protein [H00003502-P01]](https://resources.bio-techne.com/images/products/qc_test-H00003502-P01-1.jpg "SDS-PAGE: Recombinant Human IgG3 GST (N-Term) Protein [H00003502-P01]")
SDS-PAGE: Recombinant Human IgG3 GST (N-Term) Protein [H00003502-P01]
SDS-Page: Recombinant Human IgG3 Protein [H00003502-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00003502-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: IgG3
R&D Systems offers a range of secondary antibodies and controls for flow cytometry, immunohistochemistry, and Western blotting. We provide species-specific secondary antibodies that are available with a variety of conjugated labels.
Our NorthernLights fluorescent secondary antibodies are bright and resistant to photobleaching. We are currently offering secondary antibodies recognizing mouse, rat, goat, sheep, and rabbit IgG as well as chicken IgY. These reagents are available with three distinct excitation and emission maxima, making them ideal for multi-color fluorescence microscopy.
Long Name
Immunoglobulin G3
Alternate Names
DKFZp686H11213, FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, IgG3, immunoglobulin heavy constant gamma 3 (G3m marker), MGC45809
Gene Symbol
IGHG3
Additional IgG3 Products
Product Documents for Recombinant Human IgG3 GST (N-Term) Protein
Product Specific Notices for Recombinant Human IgG3 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...