IL-20R alpha Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89633PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89633PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all IL-20R alpha Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL20RA.

Source: E. coli

Amino Acid Sequence: DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89633.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89633PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-20R alpha

Official Gene Symbol: IL20RA Gene ID: 53832 (Human) Gene Map Locus: 6q22.33-q23.1 (Human) IL20RA, is a subunit of IL20R, a member of Cytokine Class II receptor super family. It consists of a central transmembrane domain and functionally induces IL20 and IL26 signaling in epithelial cells and keratinocytes. It associates with IL-20RB and forms a functional receptor complex for IL20, IL19, and IL24. It also associates with IL-10RB and forms a unique heterodimeric functional receptor complex for IL-26. Upon ligand binding, it induces signaling through activation of STAT3 and STAT1. IL20RA is specifically expressed in skin suggesting a prominent role in growth and proliferation of keratinocytes.

Long Name

Interleukin 20 Receptor alpha

Alternate Names

CRF2-8, IL-20 R alpha, IL-20R1, IL-20Ra, IL20R alpha, IL20RA, zcytor7

Gene Symbol

IL20RA

Additional IL-20R alpha Products

Product Documents for IL-20R alpha Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-20R alpha Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.