ING4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33828PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33828PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all ING4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ING4.

Source: E. coli

Amino Acid Sequence: EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33828.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33828PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ING4

p29 ING4 is a tumor suppressor protein similar to ING1 that may inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. p29 ING4 has been shown to suppress brain tumor angio-genesis through transcriptional repression of RelA/ NFKB3 target genes when complexed with RelA. p29 ING4 may also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. p29 ING4 shows a nuclear localization and interacts with EP300, TP53, RelA, inhibits cell growth, and induces apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. Multiple alternatively spliced transcript variants have been observed. The accession number listed below is for variant (1) that encodes the longest isoform.

Alternate Names

candidate tumor suppressor p33 ING1 homolog, inhibitor of growth family, member 4, inhibitor of growth protein 4, MGC12557, my036, p29ING4brain my036 protein

Gene Symbol

ING4

Additional ING4 Products

Product Documents for ING4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ING4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.