Skip to main content

ISYNA1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47415PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-47415PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISYNA1.

Source: E. coli

Amino Acid Sequence: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47415.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47415PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ISYNA1

ISYNA1 is a gene that codes for a protein which is a key enzyme in the myo-inositol biosynthesis pathway which works to convert a glucose 6-phosphate into a 1-myo-inositol 1-phosphate, as well as a rate-limiting enzyme in the synthesis of all compounds containing inositol, and is highly expressed in the testis, ovary, heart, placenta, and pancreas. ISYNA1 has three isoforms with lengths of 558, 430, and 504 amino acids and weights of approximately 61, 47, and 55 kDa respectively. Current studies are being done on several diseases and disorders relating to this gene including synostosis, Whipple disease, cerebral palsy, osteonecrosis, bipolar disorder, candidiasis, cerebtitis, osteoarthritis, and malaria. ISYNA1 has also been shown to have interactions with NME2, PPP2CA, RPS15A, CAP2, and EEF2 in pathways such as inositol phosphate metabolism pathways.

Alternate Names

EC 5.5.1.4, hINO1, hIPS, Ino1, INOS, inositol-3-phosphate synthase 1, IPSIPS 1, MI-1-P synthase, MIP synthase, Myo-inositol 1-phosphate synthase A1, Myo-inositol-1-phosphate synthase

Gene Symbol

ISYNA1

Additional ISYNA1 Products

Product Documents for ISYNA1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ISYNA1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...